Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TMSB4X purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,WB-Tr |
More info about TMSB4X purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00007114-B01P |
| Product name: | TMSB4X purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human TMSB4X protein. |
| Gene id: | 7114 |
| Gene name: | TMSB4X |
| Gene alias: | FX|PTMB4|TB4X|TMSB4 |
| Gene description: | thymosin beta 4, X-linked |
| Genbank accession: | BC001631 |
| Immunogen: | TMSB4X (AAH01631.1, 1 a.a. ~ 44 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| Protein accession: | AAH01631.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of TMSB4X expression in transfected 293T cell line (H00007114-T01) by TMSB4X MaxPab polyclonal antibody. Lane 1: TMSB4X transfected lysate(4.84 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |