Brand: | Abnova |
Reference: | H00007114-A02 |
Product name: | TMSB4X polyclonal antibody (A02) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant TMSB4X. |
Gene id: | 7114 |
Gene name: | TMSB4X |
Gene alias: | FX|PTMB4|TB4X|TMSB4 |
Gene description: | thymosin beta 4, X-linked |
Genbank accession: | NM_021109 |
Immunogen: | TMSB4X (NP_066932, 1 a.a. ~ 44 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
Protein accession: | NP_066932 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (30.95 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |