TLR5 (Human) Recombinant Protein (Q03) View larger

TLR5 (Human) Recombinant Protein (Q03)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TLR5 (Human) Recombinant Protein (Q03)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about TLR5 (Human) Recombinant Protein (Q03)

Brand: Abnova
Reference: H00007100-Q03
Product name: TLR5 (Human) Recombinant Protein (Q03)
Product description: Human TLR5 partial ORF (NP_003259.2, 351 a.a. - 450 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 7100
Gene name: TLR5
Gene alias: FLJ10052|MGC126430|MGC126431|SLEB1|TIL3
Gene description: toll-like receptor 5
Genbank accession: NM_003268
Immunogen sequence/protein sequence: LYSSNFYGLPKVAYIDLQKNHIAIIQDQTFKFLEKLQTLDLRDNALTTIHFIPSIPDIFLSGNKLVTLPKINLTANLIHLSENRLENLDILYFLLRVPHL
Protein accession: NP_003259.2
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue
Quality control testing picture: qc_test-H00007100-Q03-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TLR5 (Human) Recombinant Protein (Q03) now

Add to cart