TLR5 monoclonal antibody (M13C), clone 2E1 View larger

TLR5 monoclonal antibody (M13C), clone 2E1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TLR5 monoclonal antibody (M13C), clone 2E1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about TLR5 monoclonal antibody (M13C), clone 2E1

Brand: Abnova
Reference: H00007100-M13C
Product name: TLR5 monoclonal antibody (M13C), clone 2E1
Product description: Mouse monoclonal antibody raised against a partial recombinant TLR5.
Clone: 2E1
Isotype: IgG2b Kappa
Gene id: 7100
Gene name: TLR5
Gene alias: FLJ10052|MGC126430|MGC126431|SLEB1|TIL3
Gene description: toll-like receptor 5
Genbank accession: NM_003268
Immunogen: TLR5 (NP_003259.2, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LYSSNFYGLPKVAYIDLQKNHIAIIQDQTFKFLEKLQTLDLRDNALTTIHFIPSIPDIFLSGNKLVTLPKINLTANLIHLSENRLENLDILYFLLRVPHL
Protein accession: NP_003259.2
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy TLR5 monoclonal antibody (M13C), clone 2E1 now

Add to cart