TLR5 monoclonal antibody (M10), clone 4D12 View larger

TLR5 monoclonal antibody (M10), clone 4D12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TLR5 monoclonal antibody (M10), clone 4D12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA

More info about TLR5 monoclonal antibody (M10), clone 4D12

Brand: Abnova
Reference: H00007100-M10
Product name: TLR5 monoclonal antibody (M10), clone 4D12
Product description: Mouse monoclonal antibody raised against a full length recombinant TLR5.
Clone: 4D12
Isotype: IgG2a Kappa
Gene id: 7100
Gene name: TLR5
Gene alias: FLJ10052|MGC126430|MGC126431|SLEB1|TIL3
Gene description: toll-like receptor 5
Genbank accession: NM_003268
Immunogen: TLR5 (NP_003259.2, 351 a.a. ~ 450 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LYSSNFYGLPKVAYIDLQKNHIAIIQDQTFKFLEKLQTLDLRDNALTTIHFIPSIPDIFLSGNKLVTLPKINLTANLIHLSENRLENLDILYFLLRVPHL
Protein accession: NP_003259.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007100-M10-1-33-1.jpg
Application image note: TLR5 monoclonal antibody (M10), clone 4D12. Western Blot analysis of TLR5 expression in FHs 173 WE.
Applications: WB-Ce,ELISA
Shipping condition: Dry Ice

Reviews

Buy TLR5 monoclonal antibody (M10), clone 4D12 now

Add to cart