Brand: | Abnova |
Reference: | H00007097-M13 |
Product name: | TLR2 monoclonal antibody (M13), clone 3H8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TLR2. |
Clone: | 3H8 |
Isotype: | IgG2a Kappa |
Gene id: | 7097 |
Gene name: | TLR2 |
Gene alias: | CD282|TIL4 |
Gene description: | toll-like receptor 2 |
Genbank accession: | BC033756.1 |
Immunogen: | TLR2 (AAH33756.1, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMDTFTKIQRKDFAGLTFLEELEIDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDV |
Protein accession: | AAH33756.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |