TLR2 monoclonal antibody (M06), clone 1C6 View larger

TLR2 monoclonal antibody (M06), clone 1C6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TLR2 monoclonal antibody (M06), clone 1C6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about TLR2 monoclonal antibody (M06), clone 1C6

Brand: Abnova
Reference: H00007097-M06
Product name: TLR2 monoclonal antibody (M06), clone 1C6
Product description: Mouse monoclonal antibody raised against a partial recombinant TLR2.
Clone: 1C6
Isotype: IgG2a Kappa
Gene id: 7097
Gene name: TLR2
Gene alias: CD282|TIL4
Gene description: toll-like receptor 2
Genbank accession: BC033756.1
Immunogen: TLR2 (AAH33756.1, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMDTFTKIQRKDFAGLTFLEELEIDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDV
Protein accession: AAH33756.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy TLR2 monoclonal antibody (M06), clone 1C6 now

Add to cart