Brand: | Abnova |
Reference: | H00007083-A02 |
Product name: | TK1 polyclonal antibody (A02) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant TK1. |
Gene id: | 7083 |
Gene name: | TK1 |
Gene alias: | TK2 |
Gene description: | thymidine kinase 1, soluble |
Genbank accession: | NM_003258 |
Immunogen: | TK1 (NP_003249, 157 a.a. ~ 234 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | FREAAYTKRLGTEKEVEVIGGADKYHSVCRLCYFKKASGQPAGPDNKENCPVPGKPGEAVAARKLFAPQQILQCSPAN |
Protein accession: | NP_003249 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.69 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |