TIMP1 purified MaxPab rabbit polyclonal antibody (D01P) View larger

TIMP1 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TIMP1 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about TIMP1 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00007076-D01P
Product name: TIMP1 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human TIMP1 protein.
Gene id: 7076
Gene name: TIMP1
Gene alias: CLGI|EPA|EPO|FLJ90373|HCI|TIMP
Gene description: TIMP metallopeptidase inhibitor 1
Genbank accession: NM_003254
Immunogen: TIMP1 (AAH00866.1, 1 a.a. ~ 207 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA
Protein accession: AAH00866.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00007076-D01P-13-15-1.jpg
Application image note: Western Blot analysis of TIMP1 expression in transfected 293T cell line (H00007076-T02) by TIMP1 MaxPab polyclonal antibody.

Lane 1: TIMP1 transfected lysate(23.20 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TIMP1 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart