Brand: | Abnova |
Reference: | H00007073-A01 |
Product name: | TIAL1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant TIAL1. |
Gene id: | 7073 |
Gene name: | TIAL1 |
Gene alias: | MGC33401|TCBP|TIAR |
Gene description: | TIA1 cytotoxic granule-associated RNA binding protein-like 1 |
Genbank accession: | NM_003252 |
Immunogen: | TIAL1 (NP_003243, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MMEDDGQPRTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEHTSNDPYCFVEFYEHRDAAAALAAMNGRKILGKEVKVNWATTPSSQK |
Protein accession: | NP_003243 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.01 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | TIAL1 polyclonal antibody (A01), Lot # 051130JC01 Western Blot analysis of TIAL1 expression in MCF-7 ( Cat # L046V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |