Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TGFBR1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,WB-Ti,ELISA,WB-Re |
More info about TGFBR1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00007046-A01 |
| Product name: | TGFBR1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant TGFBR1. |
| Gene id: | 7046 |
| Gene name: | TGFBR1 |
| Gene alias: | AAT5|ACVRLK4|ALK-5|ALK5|LDS1A|LDS2A|SKR4|TGFR-1 |
| Gene description: | transforming growth factor, beta receptor 1 |
| Genbank accession: | NM_004612 |
| Immunogen: | TGFBR1 (NP_004603, 30 a.a. ~ 125 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | GATALQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVE |
| Protein accession: | NP_004603 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.67 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | TGFBR1 polyclonal antibody (A01), Lot # ABNOVA060606QCS1 Western Blot analysis of TGFBR1 expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,WB-Ti,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Critical roles of the TGF-beta type I receptor ALK5 in perichondrial formation and function, cartilage integrity, and osteoblast differentiation during growth plate development.Matsunobu T, Torigoe K, Ishikawa M, de Vega S, Kulkarni AB, Iwamoto Y, Yamada Y. Dev Biol. 2009 Aug 15;332(2):325-38. Epub 2009 Jun 6. |