Brand: | Abnova |
Reference: | H00007033-M01 |
Product name: | TFF3 monoclonal antibody (M01), clone 3D9 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant TFF3. |
Clone: | 3D9 |
Isotype: | IgG1 Kappa |
Gene id: | 7033 |
Gene name: | TFF3 |
Gene alias: | HITF|ITF|TFI|hP1.B |
Gene description: | trefoil factor 3 (intestinal) |
Genbank accession: | BC017859 |
Immunogen: | TFF3 (AAH17859.1, 15 a.a. ~ 73 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF |
Protein accession: | AAH17859.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (32.23 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to TFF3 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Circulating Serum Trefoil Factor 3 (TFF3) Is Dramatically Increased in Chronic Kidney Disease.Du TY, Luo HM, Qin HC, Wang F, Wang Q, Xiang Y, Zhang Y PLoS One. 2013 Nov 25;8(11):e80271. doi: 10.1371/journal.pone.0080271. |