TFAP2A monoclonal antibody (M03), clone 3E6 View larger

TFAP2A monoclonal antibody (M03), clone 3E6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TFAP2A monoclonal antibody (M03), clone 3E6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re

More info about TFAP2A monoclonal antibody (M03), clone 3E6

Brand: Abnova
Reference: H00007020-M03
Product name: TFAP2A monoclonal antibody (M03), clone 3E6
Product description: Mouse monoclonal antibody raised against a partial recombinant TFAP2A.
Clone: 3E6
Isotype: IgG1 Kappa
Gene id: 7020
Gene name: TFAP2A
Gene alias: AP-2|AP-2alpha|AP2TF|BOFS|TFAP2
Gene description: transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha)
Genbank accession: BC017754
Immunogen: TFAP2A (AAH17754, 99 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVF
Protein accession: AAH17754
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007020-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.4 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007020-M03-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to TFAP2A on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TFAP2A monoclonal antibody (M03), clone 3E6 now

Add to cart