Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TF monoclonal antibody (M08), clone 1C2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
More info about TF monoclonal antibody (M08), clone 1C2
| Brand: | Abnova |
| Reference: | H00007018-M08 |
| Product name: | TF monoclonal antibody (M08), clone 1C2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TF. |
| Clone: | 1C2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7018 |
| Gene name: | TF |
| Gene alias: | DKFZp781D0156|PRO1557|PRO2086 |
| Gene description: | transferrin |
| Genbank accession: | BC059367 |
| Immunogen: | TF (AAH59367, 551 a.a. ~ 650 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | FVKHQTVPQNTGGKNPDPWAKNLNEKDYELLCLDGTRKPVEEYANCHLARAPNHAVVTRKDKEACVHKILRQQQHLFGSNVTDCSGNFCLFRSETKDLLF |
| Protein accession: | AAH59367 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged TF is 0.3 ng/ml as a capture antibody. |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | NF-κB-dependent increase in tissue factor expression is responsible for hypoxic podocyte injury.Narita I, Shimada M, Yamabe H, Kinjo T, Tanno T, Nishizaki K, Kawai M, Nakamura M, Murakami R, Nakamura N, Tomita H, Saleem MA, Mathieson PW, Okumura K. Clin Exp Nephrol. 2016 Oct;20(5):679-688. Epub 2015 Dec 29. |