Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TEK monoclonal antibody (M18), clone 4G10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about TEK monoclonal antibody (M18), clone 4G10
| Brand: | Abnova |
| Reference: | H00007010-M18 |
| Product name: | TEK monoclonal antibody (M18), clone 4G10 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant TEK. |
| Clone: | 4G10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7010 |
| Gene name: | TEK |
| Gene alias: | CD202B|TIE-2|TIE2|VMCM|VMCM1 |
| Gene description: | TEK tyrosine kinase, endothelial |
| Genbank accession: | NM_000459 |
| Immunogen: | TEK (NP_000450, 66 a.a. ~ 185 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQD* |
| Protein accession: | NP_000450 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (39.31 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | TEK monoclonal antibody (M18), clone 4G10 Western Blot analysis of TEK expression in PC-12 ( Cat # L012V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |