TEK monoclonal antibody (M17), clone 4C4 View larger

TEK monoclonal antibody (M17), clone 4C4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TEK monoclonal antibody (M17), clone 4C4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about TEK monoclonal antibody (M17), clone 4C4

Brand: Abnova
Reference: H00007010-M17
Product name: TEK monoclonal antibody (M17), clone 4C4
Product description: Mouse monoclonal antibody raised against a full length recombinant TEK.
Clone: 4C4
Isotype: IgG2b Kappa
Gene id: 7010
Gene name: TEK
Gene alias: CD202B|TIE-2|TIE2|VMCM|VMCM1
Gene description: TEK tyrosine kinase, endothelial
Genbank accession: NM_000459
Immunogen: TEK (NP_000450, 66 a.a. ~ 185 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQD*
Protein accession: NP_000450
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007010-M17-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (39.31 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TEK monoclonal antibody (M17), clone 4C4 now

Add to cart