Brand: | Abnova |
Reference: | H00007010-M05 |
Product name: | TEK monoclonal antibody (M05), clone 2D2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TEK. |
Clone: | 2D2 |
Isotype: | IgG2a Kappa |
Gene id: | 7010 |
Gene name: | TEK |
Gene alias: | CD202B|TIE-2|TIE2|VMCM|VMCM1 |
Gene description: | TEK tyrosine kinase, endothelial |
Genbank accession: | BC035514 |
Immunogen: | TEK (AAH35514, 701 a.a. ~ 800 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AFSHELVTLPESQAPADLGGGKMLLIAILGSAGMTCLTVLLAFLIILQLKRANVQRRMAQAFQNVREEPAVQFNSGTLALNRKVKNNPDPTIYPVLDWND |
Protein accession: | AAH35514 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00007010-M05-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00007010-M05-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00007010-M05-1-23-1.jpg](http://www.abnova.com/application_image/H00007010-M05-1-23-1.jpg) |
Application image note: | TEK monoclonal antibody (M05), clone 2D2 Western Blot analysis of TEK expression in U-2 OS ( Cat # L022V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |