TECTA monoclonal antibody (M03), clone 2A5 View larger

TECTA monoclonal antibody (M03), clone 2A5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TECTA monoclonal antibody (M03), clone 2A5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about TECTA monoclonal antibody (M03), clone 2A5

Brand: Abnova
Reference: H00007007-M03
Product name: TECTA monoclonal antibody (M03), clone 2A5
Product description: Mouse monoclonal antibody raised against a partial recombinant TECTA.
Clone: 2A5
Isotype: IgG2a Kappa
Gene id: 7007
Gene name: TECTA
Gene alias: DFNA12|DFNA8|DFNB21
Gene description: tectorin alpha
Genbank accession: NM_005422
Immunogen: TECTA (NP_005413, 1981 a.a. ~ 2080 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: YATPTRDSNDKLRYFIIEGGCQNLKDNTIGIEENAVSLTCRFHVTVFKFIGDYDEVHLHCAVSLCDSEKYSCKITCPHNSRIATDYTKEPKEQIISVGPI
Protein accession: NP_005413
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007007-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007007-M03-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged TECTA is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TECTA monoclonal antibody (M03), clone 2A5 now

Add to cart