Brand: | Abnova |
Reference: | H00007004-M01A |
Product name: | TEAD4 monoclonal antibody (M01A), clone 5H3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TEAD4. |
Clone: | 5H3 |
Isotype: | IgG2a Kappa |
Gene id: | 7004 |
Gene name: | TEAD4 |
Gene alias: | EFTR-2|MGC9014|RTEF1|TCF13L1|TEF-3|TEFR-1|hRTEF-1B |
Gene description: | TEA domain family member 4 |
Genbank accession: | NM_003213 |
Immunogen: | TEAD4 (NP_003204, 151 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDP |
Protein accession: | NP_003204 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | TEAD4 monoclonal antibody (M01A), clone 5H3 Western Blot analysis of TEAD4 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |