TEAD4 purified MaxPab mouse polyclonal antibody (B01P) View larger

TEAD4 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TEAD4 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about TEAD4 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00007004-B01P
Product name: TEAD4 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human TEAD4 protein.
Gene id: 7004
Gene name: TEAD4
Gene alias: EFTR-2|MGC9014|RTEF1|TCF13L1|TEF-3|TEFR-1|hRTEF-1B
Gene description: TEA domain family member 4
Genbank accession: NM_201443.1
Immunogen: TEAD4 (NP_958851.1, 1 a.a. ~ 305 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
Protein accession: NP_958851.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007004-B01P-13-15-1.jpg
Application image note: Western Blot analysis of TEAD4 expression in transfected 293T cell line (H00007004-T02) by TEAD4 MaxPab polyclonal antibody.

Lane 1: TEAD4 transfected lysate(33.55 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TEAD4 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart