Brand: | Abnova |
Reference: | H00006955-M03 |
Product name: | TRA monoclonal antibody (M03), clone 4H8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TRA. |
Clone: | 4H8 |
Isotype: | IgG2a Kappa |
Gene id: | 6955 |
Gene name: | TRA |
Gene alias: | FLJ22602|MGC117436|MGC22624|MGC23964|MGC71411|TCRA|TCRD|TRA |
Gene description: | T cell receptor alpha locus |
Genbank accession: | X01403 |
Immunogen: | TRA (CAA25651.1, 133 a.a. ~ 232 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLV |
Protein accession: | CAA25651.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged TRA is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |