TCP11 monoclonal antibody (M07), clone 2E3 View larger

TCP11 monoclonal antibody (M07), clone 2E3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TCP11 monoclonal antibody (M07), clone 2E3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about TCP11 monoclonal antibody (M07), clone 2E3

Brand: Abnova
Reference: H00006954-M07
Product name: TCP11 monoclonal antibody (M07), clone 2E3
Product description: Mouse monoclonal antibody raised against a partial recombinant TCP11.
Clone: 2E3
Isotype: IgG2a Kappa
Gene id: 6954
Gene name: TCP11
Gene alias: D6S230E|KIAA0229|MGC111103
Gene description: t-complex 11 homolog (mouse)
Genbank accession: NM_018679
Immunogen: TCP11 (NP_061149.1, 342 a.a. ~ 441 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NTASLMGQLQNIAKKENCVCSVIDQRIHLFLKCCLVLGVQRSLLDLPGGLTLIEAELAELGQKFVNLTHHNQQVFGPYYTEILKTLISPAQALETKVESV
Protein accession: NP_061149.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006954-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006954-M07-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged TCP11 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TCP11 monoclonal antibody (M07), clone 2E3 now

Add to cart