Brand: | Abnova |
Reference: | H00006954-M07 |
Product name: | TCP11 monoclonal antibody (M07), clone 2E3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TCP11. |
Clone: | 2E3 |
Isotype: | IgG2a Kappa |
Gene id: | 6954 |
Gene name: | TCP11 |
Gene alias: | D6S230E|KIAA0229|MGC111103 |
Gene description: | t-complex 11 homolog (mouse) |
Genbank accession: | NM_018679 |
Immunogen: | TCP11 (NP_061149.1, 342 a.a. ~ 441 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NTASLMGQLQNIAKKENCVCSVIDQRIHLFLKCCLVLGVQRSLLDLPGGLTLIEAELAELGQKFVNLTHHNQQVFGPYYTEILKTLISPAQALETKVESV |
Protein accession: | NP_061149.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged TCP11 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |