TCOF1 monoclonal antibody (M02), clone 8H3 View larger

TCOF1 monoclonal antibody (M02), clone 8H3

H00006949-M02_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TCOF1 monoclonal antibody (M02), clone 8H3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about TCOF1 monoclonal antibody (M02), clone 8H3

Brand: Abnova
Reference: H00006949-M02
Product name: TCOF1 monoclonal antibody (M02), clone 8H3
Product description: Mouse monoclonal antibody raised against a partial recombinant TCOF1.
Clone: 8H3
Isotype: IgG1 Kappa
Gene id: 6949
Gene name: TCOF1
Gene alias: MFD1|treacle
Gene description: Treacher Collins-Franceschetti syndrome 1
Genbank accession: NM_001008657
Immunogen: TCOF1 (NP_001008657, 2 a.a. ~ 82 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AEARKRRELLPLIYHHLLRAGYVRAAREVKEQSGQKCFLAQPVTLLDIYTHWQQTSELGRKRKAEEDAALQAKKTRVSDPI
Protein accession: NP_001008657
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006949-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.65 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006949-M02-13-15-1.jpg
Application image note: Western Blot analysis of TCOF1 expression in transfected 293T cell line by TCOF1 monoclonal antibody (M02), clone 8H3.

Lane 1: TCOF1 transfected lysate(152.104 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TCOF1 monoclonal antibody (M02), clone 8H3 now

Add to cart