Brand: | Abnova |
Reference: | H00006934-M06 |
Product name: | TCF7L2 monoclonal antibody (M06), clone 3A4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TCF7L2. |
Clone: | 3A4 |
Isotype: | IgG1 Kappa |
Gene id: | 6934 |
Gene name: | TCF7L2 |
Gene alias: | TCF-4|TCF4 |
Gene description: | transcription factor 7-like 2 (T-cell specific, HMG-box) |
Genbank accession: | NM_030756 |
Immunogen: | TCF7L2 (NP_110383, 490 a.a. ~ 596 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLLAEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKSLE |
Protein accession: | NP_110383 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.51 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to TCF7L2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |