TCF7L2 monoclonal antibody (M05), clone 1A1 View larger

TCF7L2 monoclonal antibody (M05), clone 1A1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TCF7L2 monoclonal antibody (M05), clone 1A1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about TCF7L2 monoclonal antibody (M05), clone 1A1

Brand: Abnova
Reference: H00006934-M05
Product name: TCF7L2 monoclonal antibody (M05), clone 1A1
Product description: Mouse monoclonal antibody raised against a partial recombinant TCF7L2.
Clone: 1A1
Isotype: IgG1 Kappa
Gene id: 6934
Gene name: TCF7L2
Gene alias: TCF-4|TCF4
Gene description: transcription factor 7-like 2 (T-cell specific, HMG-box)
Genbank accession: NM_030756
Immunogen: TCF7L2 (NP_110383, 490 a.a. ~ 596 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLLAEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKSLE
Protein accession: NP_110383
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006934-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.51 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006934-M05-1-9-1.jpg
Application image note: TCF7L2 monoclonal antibody (M05), clone 1A1 Western Blot analysis of TCF7L2 expression in K-562 ( Cat # L009V1 ).
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TCF7L2 monoclonal antibody (M05), clone 1A1 now

Add to cart