Brand: | Abnova |
Reference: | H00006929-M01 |
Product name: | TCF3 monoclonal antibody (M01), clone 5G2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TCF3. |
Clone: | 5G2 |
Isotype: | IgG2b Kappa |
Gene id: | 6929 |
Gene name: | TCF3 |
Gene alias: | E2A|ITF1|MGC129647|MGC129648|bHLHb21 |
Gene description: | transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47) |
Genbank accession: | NM_003200 |
Immunogen: | TCF3 (NP_003191, 545 a.a. ~ 654 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVILNLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLSAPHPGLSEAHNPAGHM |
Protein accession: | NP_003191 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | TCF3 monoclonal antibody (M01), clone 5G2 Western Blot analysis of TCF3 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Synaptic Cross-talk between N-Methyl-D-aspartate Receptors and LAPSER1-{beta}-Catenin at Excitatory Synapses.Schmeisser MJ, Grabrucker AM, Bockmann J, Boeckers TM. J Biol Chem. 2009 Oct 16;284(42):29146-57. Epub 2009 Aug 24. |