TCF2 monoclonal antibody (M05), clone 4D2 View larger

TCF2 monoclonal antibody (M05), clone 4D2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TCF2 monoclonal antibody (M05), clone 4D2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about TCF2 monoclonal antibody (M05), clone 4D2

Brand: Abnova
Reference: H00006928-M05
Product name: TCF2 monoclonal antibody (M05), clone 4D2
Product description: Mouse monoclonal antibody raised against a partial recombinant TCF2.
Clone: 4D2
Isotype: IgG2a Kappa
Gene id: 6928
Gene name: HNF1B
Gene alias: FJHN|HNF1beta|HNF2|HPC11|LF-B3|LFB3|MODY5|TCF2|VHNF1
Gene description: HNF1 homeobox B
Genbank accession: NM_000458
Immunogen: TCF2 (NP_000449, 29 a.a. ~ 118 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDP
Protein accession: NP_000449
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006928-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.90 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006928-M05-13-15-1.jpg
Application image note: Western Blot analysis of HNF1B expression in transfected 293T cell line by TCF2 monoclonal antibody (M05), clone 4D2.

Lane 1: HNF1B transfected lysate (Predicted MW: 61.3 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TCF2 monoclonal antibody (M05), clone 4D2 now

Add to cart