Brand: | Abnova |
Reference: | H00006928-M04 |
Product name: | TCF2 monoclonal antibody (M04), clone 1G8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TCF2. |
Clone: | 1G8 |
Isotype: | IgG2a Kappa |
Gene id: | 6928 |
Gene name: | HNF1B |
Gene alias: | FJHN|HNF1beta|HNF2|HPC11|LF-B3|LFB3|MODY5|TCF2|VHNF1 |
Gene description: | HNF1 homeobox B |
Genbank accession: | NM_000458 |
Immunogen: | TCF2 (NP_000449, 29 a.a. ~ 118 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDP |
Protein accession: | NP_000449 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.90 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |