TBX3 monoclonal antibody (M10A), clone 3A10 View larger

TBX3 monoclonal antibody (M10A), clone 3A10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TBX3 monoclonal antibody (M10A), clone 3A10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about TBX3 monoclonal antibody (M10A), clone 3A10

Brand: Abnova
Reference: H00006926-M10A
Product name: TBX3 monoclonal antibody (M10A), clone 3A10
Product description: Mouse monoclonal antibody raised against a partial recombinant TBX3.
Clone: 3A10
Isotype: IgG2a Kappa
Gene id: 6926
Gene name: TBX3
Gene alias: TBX3-ISO|UMS|XHL
Gene description: T-box 3
Genbank accession: NM_005996
Immunogen: TBX3 (NP_005987, 311 a.a. ~ 410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KENGTSDESSSEQAAFNCFAQASSPAASTVGTSNLKDLCPSEGESDAEAESKEEHGPEACDAAKISTTTSEEPCRDKGSPAVKAHLFAAERPRDSGRLDK
Protein accession: NP_005987
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006926-M10A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006926-M10A-1-25-1.jpg
Application image note: TBX3 monoclonal antibody (M10A), clone 3A10. Western Blot analysis of TBX3 expression in Hela S3 NE ( Cat # L013V3 ). (Isoform III Mw : 65.6 kDa)
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TBX3 monoclonal antibody (M10A), clone 3A10 now

Add to cart