TBX6 monoclonal antibody (M16), clone 3F11 View larger

TBX6 monoclonal antibody (M16), clone 3F11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TBX6 monoclonal antibody (M16), clone 3F11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,ELISA

More info about TBX6 monoclonal antibody (M16), clone 3F11

Brand: Abnova
Reference: H00006911-M16
Product name: TBX6 monoclonal antibody (M16), clone 3F11
Product description: Mouse monoclonal antibody raised against a full length recombinant TBX6.
Clone: 3F11
Isotype: IgG2a Kappa
Gene id: 6911
Gene name: TBX6
Gene alias: DFNB67
Gene description: T-box 6
Genbank accession: NM_004608
Immunogen: TBX6 (NP_004599, 102 a.a. ~ 200 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KEFSSVGTEMIITKAGRRMFPACRVSVTGLDPEARYLFLLDVIPVDGARYRWQGRRWEPSGKAEPRLPDRVYIHPDSPATGAHWMRQPVSFHRVKLTNS*
Protein accession: NP_004599
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006911-M16-2-A7-1.jpg
Application image note: TBX6 monoclonal antibody (M16), clone 3F11. Western Blot analysis of TBX6 expression in human pancreas.
Applications: WB-Ti,ELISA
Shipping condition: Dry Ice

Reviews

Buy TBX6 monoclonal antibody (M16), clone 3F11 now

Add to cart