Brand: | Abnova |
Reference: | H00006911-M16 |
Product name: | TBX6 monoclonal antibody (M16), clone 3F11 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant TBX6. |
Clone: | 3F11 |
Isotype: | IgG2a Kappa |
Gene id: | 6911 |
Gene name: | TBX6 |
Gene alias: | DFNB67 |
Gene description: | T-box 6 |
Genbank accession: | NM_004608 |
Immunogen: | TBX6 (NP_004599, 102 a.a. ~ 200 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KEFSSVGTEMIITKAGRRMFPACRVSVTGLDPEARYLFLLDVIPVDGARYRWQGRRWEPSGKAEPRLPDRVYIHPDSPATGAHWMRQPVSFHRVKLTNS* |
Protein accession: | NP_004599 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | TBX6 monoclonal antibody (M16), clone 3F11. Western Blot analysis of TBX6 expression in human pancreas. |
Applications: | WB-Ti,ELISA |
Shipping condition: | Dry Ice |