TBX6 monoclonal antibody (M01), clone 2D11 View larger

TBX6 monoclonal antibody (M01), clone 2D11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TBX6 monoclonal antibody (M01), clone 2D11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA

More info about TBX6 monoclonal antibody (M01), clone 2D11

Brand: Abnova
Reference: H00006911-M01
Product name: TBX6 monoclonal antibody (M01), clone 2D11
Product description: Mouse monoclonal antibody raised against a partial recombinant TBX6.
Clone: 2D11
Isotype: IgG2b Kappa
Gene id: 6911
Gene name: TBX6
Gene alias: DFNB67
Gene description: T-box 6
Genbank accession: NM_004608
Immunogen: TBX6 (NP_004599, 191 a.a. ~ 299 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SFHRVKLTNSTLDPHGHLILHSMHKYQPRIHLVRAAQLCSQHWGGMASFRFPETTFISVTAYQNPQITQLKIAANPFAKGFRENGRNCKRERDARVKRKLRGPEPAATE
Protein accession: NP_004599
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006911-M01-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged TBX6 is approximately 3ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy TBX6 monoclonal antibody (M01), clone 2D11 now

Add to cart