Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TBX5 monoclonal antibody (M01), clone 1G10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about TBX5 monoclonal antibody (M01), clone 1G10
| Brand: | Abnova |
| Reference: | H00006910-M01 |
| Product name: | TBX5 monoclonal antibody (M01), clone 1G10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TBX5. |
| Clone: | 1G10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 6910 |
| Gene name: | TBX5 |
| Gene alias: | HOS |
| Gene description: | T-box 5 |
| Genbank accession: | BC027942 |
| Immunogen: | TBX5 (AAH27942, 402 a.a. ~ 518 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PSMPSYSSCTVTTVQPMDRLPYQHFSAHFTSGPLVPRLAGMANHGSPQLGEGMFQHQTSVAHQPVVRQCGPQTGLQSPGTLQPPEFLYSHGVPRTLSPHQYHSVHGVGMVPEWSDNS |
| Protein accession: | AAH27942 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.61 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western blot analysis of TBX5 over-expressed 293 cell line, cotransfected with TBX5 Validated Chimera RNAi ( Cat # H00006910-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TBX5 monoclonal antibody (M01), clone 1G10 (Cat # H00006910-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | Physical interaction between TBX5 and MEF2C is required for early heart development.Ghosh TK, Song FF, Packham EA, Buxton S, Robinson TE, Ronksley J, Self T, Bonser AJ, Brook JD. Mol Cell Biol. 2009 Apr;29(8):2205-18. Epub 2009 Feb 9. |