Brand: | Abnova |
Reference: | H00006909-M01A |
Product name: | TBX2 monoclonal antibody (M01A), clone 7G5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TBX2. |
Clone: | 7G5 |
Isotype: | IgG3 Kappa |
Gene id: | 6909 |
Gene name: | TBX2 |
Gene alias: | FLJ10169 |
Gene description: | T-box 2 |
Genbank accession: | NM_005994 |
Immunogen: | TBX2 (NP_005985, 603 a.a. ~ 702 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GSARPRLRFSPYQIPVTIPPSTSLLTTGLASEGSKAAGGNSREPSPLPELALRKVGAPSRGALSPSGSAKEAANELQSIQRLVSGLESQRALSPGRESPK |
Protein accession: | NP_005985 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | TBX2 monoclonal antibody (M01A), clone 7G5 Western Blot analysis of TBX2 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |