Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TBL1X monoclonal antibody (M07), clone 2B6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,S-ELISA,ELISA,PLA-Ce |
More info about TBL1X monoclonal antibody (M07), clone 2B6
| Brand: | Abnova |
| Reference: | H00006907-M07 |
| Product name: | TBL1X monoclonal antibody (M07), clone 2B6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TBL1X. |
| Clone: | 2B6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 6907 |
| Gene name: | TBL1X |
| Gene alias: | EBI|SMAP55|TBL1 |
| Gene description: | transducin (beta)-like 1X-linked |
| Genbank accession: | NM_005647 |
| Immunogen: | TBL1X (NP_005638, 478 a.a. ~ 577 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LASASFDSTVRLWDIERGVCTHTLTKHQEPVYSVAFSPDGKYLASGSFDKCVHIWNTQSGNLVHSYRGTGGIFEVCWNARGDKVGASASDGSVCVLDLRK |
| Protein accession: | NP_005638 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged TBL1X is approximately 0.3ng/ml as a capture antibody. |
| Applications: | IHC-P,S-ELISA,ELISA,PLA-Ce |
| Shipping condition: | Dry Ice |