Brand: | Abnova |
Reference: | H00006901-M13 |
Product name: | TAZ monoclonal antibody (M13), clone 1F11 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant TAZ. |
Clone: | 1F11 |
Isotype: | IgG2a Kappa |
Gene id: | 6901 |
Gene name: | TAZ |
Gene alias: | BTHS|CMD3A|EFE|EFE2|FLJ27390|G4.5|LVNCX|Taz1|XAP-2 |
Gene description: | tafazzin |
Genbank accession: | BC011515 |
Immunogen: | TAZ (AAH11515, 1 a.a. ~ 262 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MPLHVKWPFPAVPPLTWTLASSVVMGLVGTYSCFWTSEWAQAEAGPPGYPCPAGGILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCRGDGVYQKGMDFILEKLNHGDWVHIFPEGIGRLIAECHLNPIILPLWHVGEPGDGDREMASGVGGLGLPLVPGCPAPPHVWPSVHCAAGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQPGR |
Protein accession: | AAH11515 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (54.56 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | TAZ monoclonal antibody (M13), clone 1F11. Western Blot analysis of TAZ expression in human tongue. |
Applications: | WB-Ce,WB-Ti,ELISA,WB-Re |
Shipping condition: | Dry Ice |