Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TARBP2 monoclonal antibody (M04), clone 2G10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Tr |
More info about TARBP2 monoclonal antibody (M04), clone 2G10
| Brand: | Abnova |
| Reference: | H00006895-M04 |
| Product name: | TARBP2 monoclonal antibody (M04), clone 2G10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TARBP2. |
| Clone: | 2G10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 6895 |
| Gene name: | TARBP2 |
| Gene alias: | LOQS|TRBP|TRBP1|TRBP2 |
| Gene description: | TAR (HIV-1) RNA binding protein 2 |
| Genbank accession: | NM_134323 |
| Immunogen: | TARBP2 (NP_599150, 141 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RSPPMELQPPVSPQQSECNPVGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVERFIEIGSGTSKKLAKRNAAAKMLLRVHTVPLDARDGNEVEPDDDHFSIGVG |
| Protein accession: | NP_599150 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | http://www.abnova.com/application_image/ |
| Application image note: | Detection limit for recombinant GST tagged TARBP2 is approximately 30ng/ml as a capture antibody. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Tr |
| Shipping condition: | Dry Ice |