TAP1 monoclonal antibody (M02), clone 1B11 View larger

TAP1 monoclonal antibody (M02), clone 1B11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TAP1 monoclonal antibody (M02), clone 1B11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about TAP1 monoclonal antibody (M02), clone 1B11

Brand: Abnova
Reference: H00006890-M02
Product name: TAP1 monoclonal antibody (M02), clone 1B11
Product description: Mouse monoclonal antibody raised against a partial recombinant TAP1.
Clone: 1B11
Isotype: IgG3 Kappa
Gene id: 6890
Gene name: TAP1
Gene alias: ABC17|ABCB2|APT1|D6S114E|FLJ26666|FLJ41500|PSF1|RING4|TAP1*0102N|TAP1N
Gene description: transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)
Genbank accession: BC014081
Immunogen: TAP1 (AAH14081, 241 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GSETRRLSLFLVLVVLSSLGEMAIPFFTGRLTDWILQDGSADTFTRNLTLMSILTIASAVLEFVGDGIYNNTMGHVHSHLQGEVFGAVLRQETEFFQQNQTGNIMSRVTE
Protein accession: AAH14081
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006890-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006890-M02-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged TAP1 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TAP1 monoclonal antibody (M02), clone 1B11 now

Add to cart