TAL2 monoclonal antibody (M01), clone 1G6 View larger

TAL2 monoclonal antibody (M01), clone 1G6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TAL2 monoclonal antibody (M01), clone 1G6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about TAL2 monoclonal antibody (M01), clone 1G6

Brand: Abnova
Reference: H00006887-M01
Product name: TAL2 monoclonal antibody (M01), clone 1G6
Product description: Mouse monoclonal antibody raised against a partial recombinant TAL2.
Clone: 1G6
Isotype: IgG2a Kappa
Gene id: 6887
Gene name: TAL2
Gene alias: bHLHa19
Gene description: T-cell acute lymphocytic leukemia 2
Genbank accession: NM_005421
Immunogen: TAL2 (NP_005412, 29 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: IPTHPPDKKLSKNETLRLAMRYINFLVKVLGEQSLQQTGVAAQGNILGLFPQGPHLPGLEDRTLLENYQVPSPGPSHHIP
Protein accession: NP_005412
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006887-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.91 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006887-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged TAL2 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TAL2 monoclonal antibody (M01), clone 1G6 now

Add to cart