Brand: | Abnova |
Reference: | H00006882-M04 |
Product name: | TAF11 monoclonal antibody (M04), clone 2G9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TAF11. |
Clone: | 2G9 |
Isotype: | IgG1 Kappa |
Gene id: | 6882 |
Gene name: | TAF11 |
Gene alias: | MGC:15243|PRO2134|TAF2I|TAFII28 |
Gene description: | TAF11 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 28kDa |
Genbank accession: | NM_005643 |
Immunogen: | TAF11 (NP_005634, 158 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKKIIF |
Protein accession: | NP_005634 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (31.46 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to TAF11 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |