TAGLN monoclonal antibody (M03), clone 1C4 View larger

TAGLN monoclonal antibody (M03), clone 1C4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TAGLN monoclonal antibody (M03), clone 1C4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about TAGLN monoclonal antibody (M03), clone 1C4

Brand: Abnova
Reference: H00006876-M03
Product name: TAGLN monoclonal antibody (M03), clone 1C4
Product description: Mouse monoclonal antibody raised against a partial recombinant TAGLN.
Clone: 1C4
Isotype: IgG2b Kappa
Gene id: 6876
Gene name: TAGLN
Gene alias: DKFZp686P11128|SM22|SMCC|TAGLN1|WS3-10
Gene description: transgelin
Genbank accession: NM_001001522
Immunogen: TAGLN (NP_001001522, 19 a.a. ~ 112 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMF
Protein accession: NP_001001522
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006876-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.08 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006876-M03-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged TAGLN is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Cross-Reacting Antibacterial Auto-Antibodies Are Produced within Coronary Atherosclerotic Plaques of Acute Coronary Syndrome Patients.Canducci F, Saita D, Foglieni C, Piscopiello MR, Chiesa R, Colombo A, Cianflone D, Maseri A, Clementi M, Burioni R.
PLoS One. 2012;7(8):e42283. Epub 2012 Aug 6.

Reviews

Buy TAGLN monoclonal antibody (M03), clone 1C4 now

Add to cart