T monoclonal antibody (M02), clone 5C5 View larger

T monoclonal antibody (M02), clone 5C5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of T monoclonal antibody (M02), clone 5C5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr

More info about T monoclonal antibody (M02), clone 5C5

Brand: Abnova
Reference: H00006862-M02
Product name: T monoclonal antibody (M02), clone 5C5
Product description: Mouse monoclonal antibody raised against a partial recombinant T.
Clone: 5C5
Isotype: IgG2a Kappa
Gene id: 6862
Gene name: T
Gene alias: MGC104817|TFT
Gene description: T, brachyury homolog (mouse)
Genbank accession: NM_003181
Immunogen: T (NP_003172, 222 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ERSDHKEMMEEPGDSQQPGYSQWGWLLPGTSTLCPPANPHPQFGGALSLPSTHSCDRYPTLRSHRSSPYPSPYAHRNNSPTYSDNSPACLSMLQSHDNW
Protein accession: NP_003172
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006862-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006862-M02-1-16-1.jpg
Application image note: T monoclonal antibody (M02), clone 5C5 Western Blot analysis of T expression in A-549 ( Cat # L025V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy T monoclonal antibody (M02), clone 5C5 now

Add to cart