Brand: | Abnova |
Reference: | H00006860-M04 |
Product name: | SYT4 monoclonal antibody (M04), clone 5F8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SYT4. |
Clone: | 5F8 |
Isotype: | IgG3 Kappa |
Gene id: | 6860 |
Gene name: | SYT4 |
Gene alias: | HsT1192|KIAA1342 |
Gene description: | synaptotagmin IV |
Genbank accession: | NM_020783 |
Immunogen: | SYT4 (NP_065834, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAPITTSREEFDEIPTVVGIFSAFGLVFTVSLFAWICCQRKSSKSNKTPPYKFVHVLKGVDIYPENLNSKKKFGADDKNEVKNKPAVPKNSLHLDLEKR |
Protein accession: | NP_065834 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to SYT4 on A-431 cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |