SYT4 polyclonal antibody (A01) View larger

SYT4 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SYT4 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SYT4 polyclonal antibody (A01)

Brand: Abnova
Reference: H00006860-A01
Product name: SYT4 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant SYT4.
Gene id: 6860
Gene name: SYT4
Gene alias: HsT1192|KIAA1342
Gene description: synaptotagmin IV
Genbank accession: NM_020783
Immunogen: SYT4 (NP_065834, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MAPITTSREEFDEIPTVVGIFSAFGLVFTVSLFAWICCQRKSSKSNKTPPYKFVHVLKGVDIYPENLNSKKKFGADDKNEVKNKPAVPKNSLHLDLEKR
Protein accession: NP_065834
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006860-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Synaptotagmin-4 Expression in Mouse Horizontal Cells.Hirano AA, Morgans CW, Brecha NC.
Invest. Ophthalmol. Vis. Sci., May 2007; 48: 2798.

Reviews

Buy SYT4 polyclonal antibody (A01) now

Add to cart