SYN1 monoclonal antibody (M03), clone 3E3 View larger

SYN1 monoclonal antibody (M03), clone 3E3

H00006853-M03_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SYN1 monoclonal antibody (M03), clone 3E3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SYN1 monoclonal antibody (M03), clone 3E3

Brand: Abnova
Reference: H00006853-M03
Product name: SYN1 monoclonal antibody (M03), clone 3E3
Product description: Mouse monoclonal antibody raised against a partial recombinant SYN1.
Clone: 3E3
Isotype: IgG1 Kappa
Gene id: 6853
Gene name: SYN1
Gene alias: SYN1a|SYN1b|SYNI
Gene description: synapsin I
Genbank accession: NM_006950
Immunogen: SYN1 (NP_008881, 362 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMAQALPRQRQRDASPGRGSHGQTPSPGALPLGRQTSQ
Protein accession: NP_008881
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006853-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.53 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006853-M03-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged SYN1 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SYN1 monoclonal antibody (M03), clone 3E3 now

Add to cart