VAMP1 monoclonal antibody (M02), clone 5A4 View larger

VAMP1 monoclonal antibody (M02), clone 5A4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of VAMP1 monoclonal antibody (M02), clone 5A4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re

More info about VAMP1 monoclonal antibody (M02), clone 5A4

Brand: Abnova
Reference: H00006843-M02
Product name: VAMP1 monoclonal antibody (M02), clone 5A4
Product description: Mouse monoclonal antibody raised against a partial recombinant VAMP1.
Clone: 5A4
Isotype: IgG2a Lambda
Gene id: 6843
Gene name: VAMP1
Gene alias: DKFZp686H12131|SYB1|VAMP-1
Gene description: vesicle-associated membrane protein 1 (synaptobrevin 1)
Genbank accession: NM_014231
Immunogen: VAMP1 (NP_055046, 28 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCK
Protein accession: NP_055046
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006843-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.33 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006843-M02-4-12-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to VAMP1 on HepG2 cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy VAMP1 monoclonal antibody (M02), clone 5A4 now

Add to cart