Brand: | Abnova |
Reference: | H00006829-M02A |
Product name: | SUPT5H monoclonal antibody (M02A), clone 5C8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SUPT5H. |
Clone: | 5C8 |
Isotype: | IgG2b Kappa |
Gene id: | 6829 |
Gene name: | SUPT5H |
Gene alias: | FLJ34157|SPT5|SPT5H |
Gene description: | suppressor of Ty 5 homolog (S. cerevisiae) |
Genbank accession: | BC024203 |
Immunogen: | SUPT5H (AAH24203, 981 a.a. ~ 1087 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVILGEDREATGVLLSIDGEDGIVRMDLDEQLKILNLRFLGKLLEA |
Protein accession: | AAH24203 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.51 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: |  |
Application image note: | SUPT5H monoclonal antibody (M02A), clone 5C8. Western Blot analysis of SUPT5H expression in PC-12 ( Cat # L012V1 ). |
Applications: | WB-Ce,ELISA |
Shipping condition: | Dry Ice |