SUPT5H monoclonal antibody (M02A), clone 5C8 View larger

SUPT5H monoclonal antibody (M02A), clone 5C8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SUPT5H monoclonal antibody (M02A), clone 5C8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,ELISA

More info about SUPT5H monoclonal antibody (M02A), clone 5C8

Brand: Abnova
Reference: H00006829-M02A
Product name: SUPT5H monoclonal antibody (M02A), clone 5C8
Product description: Mouse monoclonal antibody raised against a partial recombinant SUPT5H.
Clone: 5C8
Isotype: IgG2b Kappa
Gene id: 6829
Gene name: SUPT5H
Gene alias: FLJ34157|SPT5|SPT5H
Gene description: suppressor of Ty 5 homolog (S. cerevisiae)
Genbank accession: BC024203
Immunogen: SUPT5H (AAH24203, 981 a.a. ~ 1087 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVILGEDREATGVLLSIDGEDGIVRMDLDEQLKILNLRFLGKLLEA
Protein accession: AAH24203
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006829-M02A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.51 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00006829-M02A-1-11-1.jpg
Application image note: SUPT5H monoclonal antibody (M02A), clone 5C8. Western Blot analysis of SUPT5H expression in PC-12 ( Cat # L012V1 ).
Applications: WB-Ce,ELISA
Shipping condition: Dry Ice

Reviews

Buy SUPT5H monoclonal antibody (M02A), clone 5C8 now

Add to cart