SUOX monoclonal antibody (M03), clone 4F2 View larger

SUOX monoclonal antibody (M03), clone 4F2

H00006821-M03_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SUOX monoclonal antibody (M03), clone 4F2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about SUOX monoclonal antibody (M03), clone 4F2

Brand: Abnova
Reference: H00006821-M03
Product name: SUOX monoclonal antibody (M03), clone 4F2
Product description: Mouse monoclonal antibody raised against a partial recombinant SUOX.
Clone: 4F2
Isotype: IgG2a Kappa
Gene id: 6821
Gene name: SUOX
Gene alias: -
Gene description: sulfite oxidase
Genbank accession: NM_000456
Immunogen: SUOX (NP_000447, 391 a.a. ~ 486 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: YAWSGGGRAVIRVDVSLDGGLTWQVAKLDGEEQRPRKAWAWRLWQLKAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLRGVLSNAWHRVHVYV
Protein accession: NP_000447
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: http://www.abnova.com/application_image/
Application image note: Detection limit for recombinant GST tagged SUOX is approximately 30ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy SUOX monoclonal antibody (M03), clone 4F2 now

Add to cart