Product successfully added to your shopping cart
Quantity
Total
There are 85 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 32 204,28 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 32 204,28 €
Data sheet of SULT1C2 purified MaxPab mouse polyclonal antibody (B02P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,WB-Tr |
More info about SULT1C2 purified MaxPab mouse polyclonal antibody (B02P)
| Brand: | Abnova |
| Reference: | H00006819-B02P |
| Product name: | SULT1C2 purified MaxPab mouse polyclonal antibody (B02P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human SULT1C2 protein. |
| Gene id: | 6819 |
| Gene name: | SULT1C2 |
| Gene alias: | ST1C1|ST1C2|SULT1C1|humSULTC2 |
| Gene description: | sulfotransferase family, cytosolic, 1C, member 2 |
| Genbank accession: | NM_001056.3 |
| Immunogen: | SULT1C2 (NP_001047.1, 1 a.a. ~ 296 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MALTSDLGKQIKLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWIQEIVDMIEQNGDVEKCQRAIIQHRHPFIEWARPPQPSGVEKAKAMPSPRILKTHLSTQLLPPSFWENNCKFLYVARNAKDCMVSYYHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFDHVKGWWEMKDRHQILFLFYEDIKRDPKHEIRKVMQFMGKKVDETVLDKIVQETSFEKMKENPMTNRSTVSKSILDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL |
| Protein accession: | NP_001047.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of SULT1C2 expression in transfected 293T cell line (H00006819-T02) by SULT1C2 MaxPab polyclonal antibody. Lane 1: SULT1C1 transfected lysate(32.56 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |