Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SULT1A1 monoclonal antibody (M01A), clone 1F8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr,IP |
More info about SULT1A1 monoclonal antibody (M01A), clone 1F8
| Brand: | Abnova |
| Reference: | H00006817-M01A |
| Product name: | SULT1A1 monoclonal antibody (M01A), clone 1F8 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant SULT1A1. |
| Clone: | 1F8 |
| Isotype: | IgM kappa |
| Gene id: | 6817 |
| Gene name: | SULT1A1 |
| Gene alias: | HAST1/HAST2|MGC131921|MGC5163|P-PST|PST|ST1A3|STP|STP1|TSPST1 |
| Gene description: | sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 |
| Genbank accession: | BC000923 |
| Immunogen: | SULT1A1 (AAH00923, 1 a.a. ~ 295 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL |
| Protein accession: | AAH00923 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (58.19 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of SULT1A1 expression in transfected 293T cell line by SULT1A1 monoclonal antibody (M01A), clone 1F8. Lane 1: SULT1A1 transfected lysate(33.925 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | The effect of bamboo extract on hepatic biotransforming enzymes ?V Findings from an obese?Vdiabetic mouse model.Koide CL, Collier AC, Berry MJ, Panee J. J Ethnopharmacol. 2010 Sep 9. [Epub ahead of print] |