Cart 61 Product Products 25 550,61 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x MRP7...259,07 €
No products
To be determined Shipping
25 550,61 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 61 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 25 550,61 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 25 550,61 €
Data sheet of SULT1A1 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Rabbit |
| Applications | WB-Ti,WB-Tr |
More info about SULT1A1 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00006817-D01P |
| Product name: | SULT1A1 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human SULT1A1 protein. |
| Gene id: | 6817 |
| Gene name: | SULT1A1 |
| Gene alias: | HAST1/HAST2|MGC131921|MGC5163|P-PST|PST|ST1A3|STP|STP1|TSPST1 |
| Gene description: | sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 |
| Genbank accession: | BC000923.2 |
| Immunogen: | SULT1A1 (AAH00923.1, 1 a.a. ~ 295 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL |
| Protein accession: | AAH00923.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | Western Blot analysis of SULT1A1 expression in transfected 293T cell line (H00006817-T02) by SULT1A1 MaxPab polyclonal antibody. Lane 1: SULT1A1 transfected lysate(34.10 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |